SDCBP purified MaxPab rabbit polyclonal antibody (D01P) View larger

SDCBP purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SDCBP purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about SDCBP purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00006386-D01P
Product name: SDCBP purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SDCBP protein.
Gene id: 6386
Gene name: SDCBP
Gene alias: MDA-9|ST1|SYCL|TACIP18
Gene description: syndecan binding protein (syntenin)
Genbank accession: NM_001007067
Immunogen: SDCBP (NP_001007068.1, 1 a.a. ~ 298 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Protein accession: NP_001007068.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00006386-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SDCBP expression in transfected 293T cell line (H00006386-T02) by SDCBP MaxPab polyclonal antibody.

Lane 1: SDCBP transfected lysate(32.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SDCBP purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart