Brand: | Abnova |
Reference: | H00006374-M03 |
Product name: | CXCL5 monoclonal antibody (M03), clone M1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CXCL5. |
Clone: | M1 |
Isotype: | IgG1 lambda |
Gene id: | 6374 |
Gene name: | CXCL5 |
Gene alias: | ENA-78|SCYB5 |
Gene description: | chemokine (C-X-C motif) ligand 5 |
Genbank accession: | BC008376 |
Immunogen: | CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN |
Protein accession: | AAH08376 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CXCL5 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |