Brand: | Abnova |
Reference: | H00006373-M10 |
Product name: | CXCL11 monoclonal antibody (M10), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CXCL11. |
Clone: | 3D9 |
Isotype: | IgG2b Kappa |
Gene id: | 6373 |
Gene name: | CXCL11 |
Gene alias: | H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1 |
Gene description: | chemokine (C-X-C motif) ligand 11 |
Genbank accession: | BC005292 |
Immunogen: | CXCL11 (AAH05292, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Protein accession: | AAH05292 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CXCL11 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |