Cart 11 Product Products 1 419,55 € (empty)
No products
To be determined Shipping
1 419,55 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 419,55 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 419,55 €
Data sheet of CXCL11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about CXCL11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006373-D01P |
| Product name: | CXCL11 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CXCL11 protein. |
| Gene id: | 6373 |
| Gene name: | CXCL11 |
| Gene alias: | H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1 |
| Gene description: | chemokine (C-X-C motif) ligand 11 |
| Genbank accession: | NM_005409 |
| Immunogen: | CXCL11 (NP_005400.1, 1 a.a. ~ 94 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
| Protein accession: | NP_005400.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of CXCL11 expression in transfected 293T cell line (H00006373-T02) by CXCL11 MaxPab polyclonal antibody. Lane 1: CXCL11 transfected lysate(10.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |