CXCL6 (Human) Recombinant Protein (P01) View larger

CXCL6 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL6 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CXCL6 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006372-P01
Product name: CXCL6 (Human) Recombinant Protein (P01)
Product description: Human CXCL6 full-length ORF ( AAH13744, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6372
Gene name: CXCL6
Gene alias: CKA-3|GCP-2|GCP2|SCYB6
Gene description: chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Genbank accession: BC013744
Immunogen sequence/protein sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Protein accession: AAH13744
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006372-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CXCL6 (Human) Recombinant Protein (P01) now

Add to cart