Brand: | Abnova |
Reference: | H00006372-M10 |
Product name: | CXCL6 monoclonal antibody (M10), clone 2G12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CXCL6. |
Clone: | 2G12 |
Isotype: | IgG2a Kappa |
Gene id: | 6372 |
Gene name: | CXCL6 |
Gene alias: | CKA-3|GCP-2|GCP2|SCYB6 |
Gene description: | chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) |
Genbank accession: | BC013744 |
Immunogen: | CXCL6 (AAH13744, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Protein accession: | AAH13744 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CXCL6 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |