Cart 40 Product Products 6 133,40 € (empty)
No products
To be determined Shipping
6 133,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 40 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 133,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 133,40 €
Data sheet of CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00006372-D01P |
| Product name: | CXCL6 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human CXCL6 protein. |
| Gene id: | 6372 |
| Gene name: | CXCL6 |
| Gene alias: | CKA-3|GCP-2|GCP2|SCYB6 |
| Gene description: | chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) |
| Genbank accession: | NM_002993 |
| Immunogen: | CXCL6 (NP_002984.1, 1 a.a. ~ 114 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
| Protein accession: | NP_002984.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CXCL6 expression in transfected 293T cell line (H00006372-T02) by CXCL6 MaxPab polyclonal antibody. Lane 1: CXCL6 transfected lysate(11.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Effect of alginate encapsulation on the cellular transcriptome of human islets.Vaithilingam V, Quayum N, Joglekar MV, Jensen J, Hardikar AA, Oberholzer J, Guillemin GJ, Tuch BE. Biomaterials. 2011 Sep 1. [Epub ahead of print] |