CCL21 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CCL21 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL21 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CCL21 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00006366-D01P
Product name: CCL21 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CCL21 protein.
Gene id: 6366
Gene name: CCL21
Gene alias: 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4
Gene description: chemokine (C-C motif) ligand 21
Genbank accession: NM_002989
Immunogen: CCL21 (NP_002980.1, 1 a.a. ~ 134 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Protein accession: NP_002980.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00006366-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CCL21 expression in transfected 293T cell line (H00006366-T01) by CCL21 MaxPab polyclonal antibody.

Lane 1: CCL21 transfected lysate(14.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CCL21 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart