Brand: | Abnova |
Reference: | H00006359-M04 |
Product name: | CCL15 monoclonal antibody (M04), clone 3B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL15. |
Clone: | 3B7 |
Isotype: | IgG2a Kappa |
Gene id: | 6359 |
Gene name: | CCL15 |
Gene alias: | HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15 |
Gene description: | chemokine (C-C motif) ligand 15 |
Genbank accession: | NM_032965 |
Immunogen: | CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
Protein accession: | NP_116741 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CCL15 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |