CCL15 monoclonal antibody (M03), clone 3H1 View larger

CCL15 monoclonal antibody (M03), clone 3H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL15 monoclonal antibody (M03), clone 3H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CCL15 monoclonal antibody (M03), clone 3H1

Brand: Abnova
Reference: H00006359-M03
Product name: CCL15 monoclonal antibody (M03), clone 3H1
Product description: Mouse monoclonal antibody raised against a partial recombinant CCL15.
Clone: 3H1
Isotype: IgG2a Kappa
Gene id: 6359
Gene name: CCL15
Gene alias: HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene description: chemokine (C-C motif) ligand 15
Genbank accession: NM_032965
Immunogen: CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Protein accession: NP_116741
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006359-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CCL15 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CCL15 monoclonal antibody (M03), clone 3H1 now

Add to cart