Brand: | Abnova |
Reference: | H00006358-M01 |
Product name: | CCL14 monoclonal antibody (M01), clone 1F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL14. |
Clone: | 1F12 |
Isotype: | IgG2b Kappa |
Gene id: | 6358 |
Gene name: | CCL14 |
Gene alias: | CC-1|CC-3|CKb1|HCC-1|HCC-3|MCIF|NCC-2|NCC2|SCYA14|SCYL2|SY14 |
Gene description: | chemokine (C-C motif) ligand 14 |
Genbank accession: | BC045165 |
Immunogen: | CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Protein accession: | AAH45165 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |