Brand: | Abnova |
Reference: | H00006357-A01 |
Product name: | CCL13 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CCL13. |
Gene id: | 6357 |
Gene name: | CCL13 |
Gene alias: | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
Gene description: | chemokine (C-C motif) ligand 13 |
Genbank accession: | BC008621 |
Immunogen: | CCL13 (AAH08621, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Protein accession: | AAH08621 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |