CCL3 (Human) Recombinant Protein (P01) View larger

CCL3 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL3 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CCL3 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006348-P01
Product name: CCL3 (Human) Recombinant Protein (P01)
Product description: Human CCL3 full-length ORF ( NP_002974.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6348
Gene name: CCL3
Gene alias: G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
Gene description: chemokine (C-C motif) ligand 3
Genbank accession: NM_002983.1
Immunogen sequence/protein sequence: MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein accession: NP_002974.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006348-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: NK cell intrinsic regulation of MIP-1α by granzyme M.Baschuk N, Wang N, Watt SV, Halse H, House C, Bird PI, Strugnell R, Trapani JA, Smyth MJ, Andrews DM
Cell Death Dis. 2014 Mar 13;5:e1115. doi: 10.1038/cddis.2014.74.

Reviews

Buy CCL3 (Human) Recombinant Protein (P01) now

Add to cart