Cart 31 Product Products 2 996,77 € (empty)
No products
To be determined Shipping
2 996,77 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 31 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 996,77 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 996,77 €
Data sheet of CCL3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CCL3 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00006348-B01P |
| Product name: | CCL3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CCL3 protein. |
| Gene id: | 6348 |
| Gene name: | CCL3 |
| Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene description: | chemokine (C-C motif) ligand 3 |
| Genbank accession: | NM_002983 |
| Immunogen: | CCL3 (NP_002974, 1 a.a. ~ 92 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Protein accession: | NP_002974 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCL3 expression in transfected 293T cell line (H00006348-T02) by CCL3 MaxPab polyclonal antibody. Lane 1: CCL3 transfected lysate(10.12 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |