Brand: | Abnova |
Reference: | H00006348-A01 |
Product name: | CCL3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CCL3. |
Gene id: | 6348 |
Gene name: | CCL3 |
Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
Gene description: | chemokine (C-C motif) ligand 3 |
Genbank accession: | NM_002983 |
Immunogen: | CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Protein accession: | NP_002974 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |