Brand: | Abnova |
Reference: | H00006346-M02 |
Product name: | CCL1 monoclonal antibody (M02), clone 4E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CCL1. |
Clone: | 4E4 |
Isotype: | IgG2b Kappa |
Gene id: | 6346 |
Gene name: | CCL1 |
Gene alias: | I-309|P500|SCYA1|SISe|TCA3 |
Gene description: | chemokine (C-C motif) ligand 1 |
Genbank accession: | NM_002981 |
Immunogen: | CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Protein accession: | NP_002972 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CCL1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |