H00006335-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006335-M01 |
Product name: | SCN9A monoclonal antibody (M01), clone 5A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SCN9A. |
Clone: | 5A11 |
Isotype: | IgG2b Kappa |
Gene id: | 6335 |
Gene name: | SCN9A |
Gene alias: | ETHA|NE-NA|NENA|Nav1.7|PN1 |
Gene description: | sodium channel, voltage-gated, type IX, alpha subunit |
Genbank accession: | NM_002977 |
Immunogen: | SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY |
Protein accession: | NP_002968 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged SCN9A is approximately 10ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |