Brand: | Abnova |
Reference: | H00006327-M01 |
Product name: | SCN2B monoclonal antibody (M01), clone 2G11-C12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SCN2B. |
Clone: | 2G11-C12 |
Isotype: | IgG1 Kappa |
Gene id: | 6327 |
Gene name: | SCN2B |
Gene alias: | - |
Gene description: | sodium channel, voltage-gated, type II, beta |
Genbank accession: | BC036793 |
Immunogen: | SCN2B (AAH36793, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK |
Protein accession: | AAH36793 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SCN2B is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |