Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006322-M01 |
Product name: | SCML1 monoclonal antibody (M01), clone 4G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SCML1. |
Clone: | 4G3 |
Isotype: | IgG2a Kappa |
Gene id: | 6322 |
Gene name: | SCML1 |
Gene alias: | - |
Gene description: | sex comb on midleg-like 1 (Drosophila) |
Genbank accession: | NM_006746 |
Immunogen: | SCML1 (NP_006737, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHN |
Protein accession: | NP_006737 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SCML1 expression in transfected 293T cell line by SCML1 monoclonal antibody (M01), clone 4G3. Lane 1: SCML1 transfected lysate(23.131 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |