Brand: | Abnova |
Reference: | H00006320-M01 |
Product name: | CLEC11A monoclonal antibody (M01), clone 3E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CLEC11A. |
Clone: | 3E1 |
Isotype: | IgG2b lambda |
Gene id: | 6320 |
Gene name: | CLEC11A |
Gene alias: | CLECSF3|LSLCL|P47|SCGF |
Gene description: | C-type lectin domain family 11, member A |
Genbank accession: | NM_002975 |
Immunogen: | CLEC11A (NP_002966, 214 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
Protein accession: | NP_002966 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |