Brand: | Abnova |
Reference: | H00006319-M02 |
Product name: | SCD monoclonal antibody (M02), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SCD. |
Clone: | 1B7 |
Isotype: | IgG2a Kappa |
Gene id: | 6319 |
Gene name: | SCD |
Gene alias: | FADS5|MSTP008|SCD1 |
Gene description: | stearoyl-CoA desaturase (delta-9-desaturase) |
Genbank accession: | NM_005063.4 |
Immunogen: | SCD (NP_005054.3, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT |
Protein accession: | NP_005054.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SCD monoclonal antibody (M02), clone 1B7. Western Blot analysis of SCD expression in MCF-7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |