S100B (Human) Recombinant Protein (P02) View larger

S100B (Human) Recombinant Protein (P02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100B (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about S100B (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00006285-P02
Product name: S100B (Human) Recombinant Protein (P02)
Product description: Human S100B full-length ORF (NP_006263.1, 1 a.a. - 92 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 6285
Gene name: S100B
Gene alias: NEF|S100|S100beta
Gene description: S100 calcium binding protein B
Genbank accession: NM_006272.1
Immunogen sequence/protein sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Protein accession: NP_006263.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00006285-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100B (Human) Recombinant Protein (P02) now

Add to cart