S100A12 monoclonal antibody (M10A), clone 1F10 View larger

S100A12 monoclonal antibody (M10A), clone 1F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A12 monoclonal antibody (M10A), clone 1F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about S100A12 monoclonal antibody (M10A), clone 1F10

Brand: Abnova
Reference: H00006283-M10A
Product name: S100A12 monoclonal antibody (M10A), clone 1F10
Product description: Mouse monoclonal antibody raised against a partial recombinant S100A12.
Clone: 1F10
Isotype: IgG2a Kappa
Gene id: 6283
Gene name: S100A12
Gene alias: CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6
Gene description: S100 calcium binding protein A12
Genbank accession: NM_005621.1
Immunogen: S100A12 (NP_005612.1, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Protein accession: NP_005612.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006283-M10A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006283-M10A-13-15-1.jpg
Application image note: Western Blot analysis of S100A12 expression in transfected 293T cell line by S100A12 monoclonal antibody (M10A), clone 1F10.

Lane 1: S100A12 transfected lysate (Predicted MW: 10.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy S100A12 monoclonal antibody (M10A), clone 1F10 now

Add to cart