Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006283-M10A |
Product name: | S100A12 monoclonal antibody (M10A), clone 1F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant S100A12. |
Clone: | 1F10 |
Isotype: | IgG2a Kappa |
Gene id: | 6283 |
Gene name: | S100A12 |
Gene alias: | CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6 |
Gene description: | S100 calcium binding protein A12 |
Genbank accession: | NM_005621.1 |
Immunogen: | S100A12 (NP_005612.1, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Protein accession: | NP_005612.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of S100A12 expression in transfected 293T cell line by S100A12 monoclonal antibody (M10A), clone 1F10. Lane 1: S100A12 transfected lysate (Predicted MW: 10.6 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |