Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A9 monoclonal antibody (M01A), clone 1C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about S100A9 monoclonal antibody (M01A), clone 1C10
| Brand: | Abnova |
| Reference: | H00006280-M01A |
| Product name: | S100A9 monoclonal antibody (M01A), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant S100A9. |
| Clone: | 1C10 |
| Isotype: | IgG |
| Gene id: | 6280 |
| Gene name: | S100A9 |
| Gene alias: | 60B8AG|CAGB|CFAG|CGLB|L1AG|LIAG|MAC387|MIF|MRP14|NIF|P14 |
| Gene description: | S100 calcium binding protein A9 |
| Genbank accession: | BC047681 |
| Immunogen: | S100A9 (AAH47681, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
| Protein accession: | AAH47681 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | S100A9 monoclonal antibody (M01A), clone 1C10 Western Blot analysis of S100A9 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteomic profiling of inflammatory signaling molecules in the tears of patients on chronic glaucoma medication.Wong TT, Zhou L, Li J, Tong L, Zhao SZ, Li XR, Yu SJ, Koh SK, Beuerman RW. Invest Ophthalmol Vis Sci. 2011 Sep 22;52(10):7385-91. |