S100A8 polyclonal antibody (A02) View larger

S100A8 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A8 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about S100A8 polyclonal antibody (A02)

Brand: Abnova
Reference: H00006279-A02
Product name: S100A8 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant S100A8.
Gene id: 6279
Gene name: S100A8
Gene alias: 60B8AG|CAGA|CFAG|CGLA|CP-10|L1Ag|MA387|MIF|MRP8|NIF|P8
Gene description: S100 calcium binding protein A8
Genbank accession: NM_002964
Immunogen: S100A8 (NP_002955, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHK
Protein accession: NP_002955
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006279-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100A8 polyclonal antibody (A02) now

Add to cart