View larger

S100A7 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of S100A7 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00006278-P01
Product name:	S100A7 (Human) Recombinant Protein (P01)
Product description:	Human S100A7 full-length ORF ( AAH34687.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	6278
Gene name:	S100A7
Gene alias:	PSOR1\|S100A7c
Gene description:	S100 calcium binding protein A7
Genbank accession:	BC034687.1
Immunogen sequence/protein sequence:	MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Protein accession:	AAH34687.1
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation.Shubbar E, Vegfors J, Carlstrom M, Petersson S, Enerback C. Breast Cancer Res Treat. 2011 Dec 22.