Brand: | Abnova |
Reference: | H00006278-M02 |
Product name: | S100A7 monoclonal antibody (M02), clone 1A4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant S100A7. |
Clone: | 1A4 |
Isotype: | IgG1 Kappa |
Gene id: | 6278 |
Gene name: | S100A7 |
Gene alias: | PSOR1|S100A7c |
Gene description: | S100 calcium binding protein A7 |
Genbank accession: | BC034687.1 |
Immunogen: | S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
Protein accession: | AAH34687.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to S100A7 on A-431 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |