S100A7 monoclonal antibody (M02), clone 1A4 View larger

S100A7 monoclonal antibody (M02), clone 1A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A7 monoclonal antibody (M02), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about S100A7 monoclonal antibody (M02), clone 1A4

Brand: Abnova
Reference: H00006278-M02
Product name: S100A7 monoclonal antibody (M02), clone 1A4
Product description: Mouse monoclonal antibody raised against a full-length recombinant S100A7.
Clone: 1A4
Isotype: IgG1 Kappa
Gene id: 6278
Gene name: S100A7
Gene alias: PSOR1|S100A7c
Gene description: S100 calcium binding protein A7
Genbank accession: BC034687.1
Immunogen: S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Protein accession: AAH34687.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006278-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006278-M02-4-4-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to S100A7 on A-431 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy S100A7 monoclonal antibody (M02), clone 1A4 now

Add to cart