Cart 6 Product Products 616,68 € (empty)
No products
To be determined Shipping
616,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 616,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 616,68 €
Data sheet of S100A7 purified MaxPab rabbit polyclonal antibody (D03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr |
More info about S100A7 purified MaxPab rabbit polyclonal antibody (D03P)
| Brand: | Abnova |
| Reference: | H00006278-D03P |
| Product name: | S100A7 purified MaxPab rabbit polyclonal antibody (D03P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human S100A7 protein. |
| Gene id: | 6278 |
| Gene name: | S100A7 |
| Gene alias: | PSOR1|S100A7c |
| Gene description: | S100 calcium binding protein A7 |
| Genbank accession: | BC034687 |
| Immunogen: | S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Protein accession: | AAH34687 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of S100A7 expression in transfected 293T cell line (H00006278-T01) by S100A7 MaxPab polyclonal antibody. Lane 1: S100A7 transfected lysate(11.22 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |