Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A7 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about S100A7 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006278-A01 |
| Product name: | S100A7 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant S100A7. |
| Gene id: | 6278 |
| Gene name: | S100A7 |
| Gene alias: | PSOR1|S100A7c |
| Gene description: | S100 calcium binding protein A7 |
| Genbank accession: | BC034687.1 |
| Immunogen: | S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Protein accession: | AAH34687.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.Mueller C, Zhou W, Vanmeter A, Heiby M, Magaki S, Ross MM, Espina V, Schrag M, Dickson C, Liotta LA, Kirsch WM. J Alzheimers Dis. 2010 Jan;19(3):1081-91. |