Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A6 monoclonal antibody (M10), clone 6B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about S100A6 monoclonal antibody (M10), clone 6B5
| Brand: | Abnova |
| Reference: | H00006277-M10 |
| Product name: | S100A6 monoclonal antibody (M10), clone 6B5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant S100A6. |
| Clone: | 6B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6277 |
| Gene name: | S100A6 |
| Gene alias: | 2A9|5B10|CABP|CACY|PRA |
| Gene description: | S100 calcium binding protein A6 |
| Genbank accession: | BC001431 |
| Immunogen: | S100A6 (AAH01431, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
| Protein accession: | AAH01431 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to S100A6 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells.Chen Y, Huang K, Nakatsu MN, Xue Z, Deng SX, Fan G. Hum Mol Genet. 2013 Jan 8. |