S100A5 polyclonal antibody (A01) View larger

S100A5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about S100A5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006276-A01
Product name: S100A5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant S100A5.
Gene id: 6276
Gene name: S100A5
Gene alias: S100D
Gene description: S100 calcium binding protein A5
Genbank accession: NM_002962
Immunogen: S100A5 (NP_002953, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY
Protein accession: NP_002953
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006276-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006276-A01-2-A5-1.jpg
Application image note: S100A5 polyclonal antibody (A01), Lot # 060707JCS1. Western Blot analysis of S100A5 expression in human ovarian cancer.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100A5 polyclonal antibody (A01) now

Add to cart