View larger

S100A4 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of S100A4 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00006275-P01
Product name:	S100A4 (Human) Recombinant Protein (P01)
Product description:	Human S100A4 full-length ORF ( AAH16300, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	6275
Gene name:	S100A4
Gene alias:	18A2\|42A\|CAPL\|FSP1\|MTS1\|P9KA\|PEL98
Gene description:	S100 calcium binding protein A4
Genbank accession:	BC016300
Immunogen sequence/protein sequence:	MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Protein accession:	AAH16300
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Overexpression of S100A4 in human cancer cell lines resistant to methotrexate.Mencia N, Selga E, Rico I, de Almagro MC, Villalobos X, Ramirez S, Adan J, Hernandez JL, Noe V, Ciudad CJ. BMC Cancer. 2010 Jun 1;10:250.