Brand: | Abnova |
Reference: | H00006274-M01 |
Product name: | S100A3 monoclonal antibody (M01), clone 1D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant S100A3. |
Clone: | 1D4 |
Isotype: | IgG2a Kappa |
Gene id: | 6274 |
Gene name: | S100A3 |
Gene alias: | S100E |
Gene description: | S100 calcium binding protein A3 |
Genbank accession: | NM_002960 |
Immunogen: | S100A3 (NP_002951, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
Protein accession: | NP_002951 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged S100A3 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |