S100A2 monoclonal antibody (M06), clone M2 View larger

S100A2 monoclonal antibody (M06), clone M2

H00006273-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A2 monoclonal antibody (M06), clone M2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about S100A2 monoclonal antibody (M06), clone M2

Brand: Abnova
Reference: H00006273-M06
Product name: S100A2 monoclonal antibody (M06), clone M2
Product description: Mouse monoclonal antibody raised against a full length recombinant S100A2.
Clone: M2
Isotype: IgG2a Kappa
Gene id: 6273
Gene name: S100A2
Gene alias: CAN19|MGC111539|S100L
Gene description: S100 calcium binding protein A2
Genbank accession: BC002829
Immunogen: S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Protein accession: AAH02829
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006273-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006273-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged S100A2 is approximately 0.03ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy S100A2 monoclonal antibody (M06), clone M2 now

Add to cart