SORT1 monoclonal antibody (M01), clone 1B3 View larger

SORT1 monoclonal antibody (M01), clone 1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORT1 monoclonal antibody (M01), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SORT1 monoclonal antibody (M01), clone 1B3

Brand: Abnova
Reference: H00006272-M01
Product name: SORT1 monoclonal antibody (M01), clone 1B3
Product description: Mouse monoclonal antibody raised against a partial recombinant SORT1.
Clone: 1B3
Isotype: IgG2a Kappa
Gene id: 6272
Gene name: SORT1
Gene alias: Gp95|NT3
Gene description: sortilin 1
Genbank accession: NM_002959
Immunogen: SORT1 (NP_002950, 203 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Protein accession: NP_002950
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006272-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00006272-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SORT1 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SORT1 monoclonal antibody (M01), clone 1B3 now

Add to cart