Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100A1 monoclonal antibody (M01), clone 1D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about S100A1 monoclonal antibody (M01), clone 1D5
| Brand: | Abnova |
| Reference: | H00006271-M01 |
| Product name: | S100A1 monoclonal antibody (M01), clone 1D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant S100A1. |
| Clone: | 1D5 |
| Isotype: | IgG1 kappa |
| Gene id: | 6271 |
| Gene name: | S100A1 |
| Gene alias: | S100|S100-alpha|S100A |
| Gene description: | S100 calcium binding protein A1 |
| Genbank accession: | NM_006271 |
| Immunogen: | S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY |
| Protein accession: | NP_006262 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged S100A1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | FISH Scoring on Paraffin Sections Versus Single-cell Suspension for Chromophobe Renal Carcinoma and Renal Oncocytoma.Brunelli M, Segala D, Delahunt B, Parolini C, Bersani S, Cheng L, Eble JN, Chilosi M, Gobbo S, Martignoni G. Anticancer Res. 2011 Oct;31(10):3137-42. |