Brand: | Abnova |
Reference: | H00006257-M12 |
Product name: | RXRB monoclonal antibody (M12), clone 1H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RXRB. |
Clone: | 1H1 |
Isotype: | IgG2b Kappa |
Gene id: | 6257 |
Gene name: | RXRB |
Gene alias: | DAUDI6|H-2RIIBP|MGC1831|NR2B2|RCoR-1 |
Gene description: | retinoid X receptor, beta |
Genbank accession: | BC001167 |
Immunogen: | RXRB (AAH01167.1, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC |
Protein accession: | AAH01167.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RXRB is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |