RXRB monoclonal antibody (M10), clone 2E6 View larger

RXRB monoclonal antibody (M10), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RXRB monoclonal antibody (M10), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RXRB monoclonal antibody (M10), clone 2E6

Brand: Abnova
Reference: H00006257-M10
Product name: RXRB monoclonal antibody (M10), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant RXRB.
Clone: 2E6
Isotype: IgG1 Kappa
Gene id: 6257
Gene name: RXRB
Gene alias: DAUDI6|H-2RIIBP|MGC1831|NR2B2|RCoR-1
Gene description: retinoid X receptor, beta
Genbank accession: BC001167
Immunogen: RXRB (AAH01167.1, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
Protein accession: AAH01167.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006257-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006257-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged RXRB is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RXRB monoclonal antibody (M10), clone 2E6 now

Add to cart