RXRA monoclonal antibody (M34A), clone 3F5 View larger

RXRA monoclonal antibody (M34A), clone 3F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RXRA monoclonal antibody (M34A), clone 3F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RXRA monoclonal antibody (M34A), clone 3F5

Brand: Abnova
Reference: H00006256-M34A
Product name: RXRA monoclonal antibody (M34A), clone 3F5
Product description: Mouse monoclonal antibody raised against a partial recombinant RXRA.
Clone: 3F5
Isotype: IgG2a Kappa
Gene id: 6256
Gene name: RXRA
Gene alias: FLJ00280|FLJ00318|FLJ16020|FLJ16733|MGC102720|NR2B1
Gene description: retinoid X receptor, alpha
Genbank accession: NM_002957
Immunogen: RXRA (NP_002948.1, 27 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Protein accession: NP_002948.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006256-M34A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RXRA monoclonal antibody (M34A), clone 3F5 now

Add to cart