Brand: | Abnova |
Reference: | H00006241-M01A |
Product name: | RRM2 monoclonal antibody (M01A), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RRM2. |
Clone: | 1E1 |
Isotype: | IgG1 Kappa |
Gene id: | 6241 |
Gene name: | RRM2 |
Gene alias: | R2|RR2M |
Gene description: | ribonucleotide reductase M2 polypeptide |
Genbank accession: | NM_001034 |
Immunogen: | RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS |
Protein accession: | NP_001025 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RRM2 monoclonal antibody (M01A), clone 1E1. Western Blot analysis of RRM2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |