Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RRM2 monoclonal antibody (M01), clone 1E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,IP |
More info about RRM2 monoclonal antibody (M01), clone 1E1
| Brand: | Abnova |
| Reference: | H00006241-M01 |
| Product name: | RRM2 monoclonal antibody (M01), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RRM2. |
| Clone: | 1E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6241 |
| Gene name: | RRM2 |
| Gene alias: | R2|RR2M |
| Gene description: | ribonucleotide reductase M2 polypeptide |
| Genbank accession: | NM_001034 |
| Immunogen: | RRM2 (NP_001025, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLS |
| Protein accession: | NP_001025 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | RRM1 maintains centrosomal integrity via CHK1 and CDK1 signaling during replication stress.Kim SH, Park ER, Joo HY, Shen YN, Hong SH, Kim CH, Singh R, Lee KH, Shin HJ Cancer Lett. 2014 Jan 14. pii: S0304-3835(14)00014-7. doi: 10.1016/j.canlet.2013.12.031. |