RRM1 monoclonal antibody (M07), clone 2G6 View larger

RRM1 monoclonal antibody (M07), clone 2G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RRM1 monoclonal antibody (M07), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about RRM1 monoclonal antibody (M07), clone 2G6

Brand: Abnova
Reference: H00006240-M07
Product name: RRM1 monoclonal antibody (M07), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant RRM1.
Clone: 2G6
Isotype: IgG2a Kappa
Gene id: 6240
Gene name: RRM1
Gene alias: R1|RIR1|RR1
Gene description: ribonucleotide reductase M1
Genbank accession: NM_001033.2
Immunogen: RRM1 (NP_001024.1, 593 a.a. ~ 792 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Protein accession: NP_001024.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006240-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006240-M07-13-15-1.jpg
Application image note: Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M07), clone 2G6.

Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RRM1 monoclonal antibody (M07), clone 2G6 now

Add to cart