Brand: | Abnova |
Reference: | H00006233-A01 |
Product name: | RPS27A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant RPS27A. |
Gene id: | 6233 |
Gene name: | RPS27A |
Gene alias: | CEP80|HUBCEP80|UBA80|UBCEP1|UBCEP80 |
Gene description: | ribosomal protein S27a |
Genbank accession: | BC001392 |
Immunogen: | RPS27A (AAH01392, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK |
Protein accession: | AAH01392 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |