RPS17 monoclonal antibody (M01A), clone 2C7 View larger

RPS17 monoclonal antibody (M01A), clone 2C7

H00006218-M01A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS17 monoclonal antibody (M01A), clone 2C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RPS17 monoclonal antibody (M01A), clone 2C7

Brand: Abnova
Reference: H00006218-M01A
Product name: RPS17 monoclonal antibody (M01A), clone 2C7
Product description: Mouse monoclonal antibody raised against a partial recombinant RPS17.
Clone: 2C7
Isotype: IgG1 Kappa
Gene id: 6218
Gene name: RPS17
Gene alias: DBA4|MGC72007|RPS17L1|RPS17L2
Gene description: ribosomal protein S17
Genbank accession: NM_001021
Immunogen: RPS17 (NP_001012, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV
Protein accession: NP_001012
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006218-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006218-M01A-1-1-1.jpg
Application image note: RPS17 monoclonal antibody (M01A), clone 2C7 Western Blot analysis of RPS17 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPS17 monoclonal antibody (M01A), clone 2C7 now

Add to cart