H00006218-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006218-M01A |
Product name: | RPS17 monoclonal antibody (M01A), clone 2C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS17. |
Clone: | 2C7 |
Isotype: | IgG1 Kappa |
Gene id: | 6218 |
Gene name: | RPS17 |
Gene alias: | DBA4|MGC72007|RPS17L1|RPS17L2 |
Gene description: | ribosomal protein S17 |
Genbank accession: | NM_001021 |
Immunogen: | RPS17 (NP_001012, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV |
Protein accession: | NP_001012 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | RPS17 monoclonal antibody (M01A), clone 2C7 Western Blot analysis of RPS17 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |