RPS7 polyclonal antibody (A01) View larger

RPS7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RPS7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00006201-A01
Product name: RPS7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RPS7.
Gene id: 6201
Gene name: RPS7
Gene alias: -
Gene description: ribosomal protein S7
Genbank accession: NM_001011
Immunogen: RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Protein accession: NP_001002
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006201-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006201-A01-1-7-1.jpg
Application image note: RPS7 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of RPS7 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPS7 polyclonal antibody (A01) now

Add to cart