Cart 5 Product Products 1 526,44 € (empty)
-
-
1 x Mouse...290,00 € -
-
-
No products
To be determined Shipping
1 526,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 526,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 526,44 €
Data sheet of RPS6KB2 monoclonal antibody (M08), clone 4B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RPS6KB2 monoclonal antibody (M08), clone 4B11
| Brand: | Abnova |
| Reference: | H00006199-M08 |
| Product name: | RPS6KB2 monoclonal antibody (M08), clone 4B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KB2. |
| Clone: | 4B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6199 |
| Gene name: | RPS6KB2 |
| Gene alias: | KLS|P70-beta|P70-beta-1|P70-beta-2|S6K-beta2|S6K2|SRK|STK14B|p70(S6K)-beta|p70S6Kb |
| Gene description: | ribosomal protein S6 kinase, 70kDa, polypeptide 2 |
| Genbank accession: | BC006106 |
| Immunogen: | RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV |
| Protein accession: | AAH06106 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RPS6KB2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |