H00006197-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re,PLA-Ce |
Brand: | Abnova |
Reference: | H00006197-M01 |
Product name: | RPS6KA3 monoclonal antibody (M01), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KA3. |
Clone: | 2G10 |
Isotype: | IgG2b Kappa |
Gene id: | 6197 |
Gene name: | RPS6KA3 |
Gene alias: | CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|RSK|RSK2|S6K-alpha3|p90-RSK2|pp90RSK2 |
Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 3 |
Genbank accession: | NM_004586 |
Immunogen: | RPS6KA3 (NP_004577, 2 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ |
Protein accession: | NP_004577 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | RPS6KA3 monoclonal antibody (M01), clone 2G10. Western Blot analysis of RPS6KA3 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |