RPS6KA1 monoclonal antibody (M01), clone 2E3 View larger

RPS6KA1 monoclonal antibody (M01), clone 2E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS6KA1 monoclonal antibody (M01), clone 2E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RPS6KA1 monoclonal antibody (M01), clone 2E3

Brand: Abnova
Reference: H00006195-M01
Product name: RPS6KA1 monoclonal antibody (M01), clone 2E3
Product description: Mouse monoclonal antibody raised against a partial recombinant RPS6KA1.
Clone: 2E3
Isotype: IgG2b Kappa
Gene id: 6195
Gene name: RPS6KA1
Gene alias: HU-1|MAPKAPK1A|RSK|RSK1
Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 1
Genbank accession: NM_002953
Immunogen: RPS6KA1 (NP_002944, 342 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD
Protein accession: NP_002944
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006195-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.25 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPS6KA1 monoclonal antibody (M01), clone 2E3 now

Add to cart