Brand: | Abnova |
Reference: | H00006195-M01 |
Product name: | RPS6KA1 monoclonal antibody (M01), clone 2E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KA1. |
Clone: | 2E3 |
Isotype: | IgG2b Kappa |
Gene id: | 6195 |
Gene name: | RPS6KA1 |
Gene alias: | HU-1|MAPKAPK1A|RSK|RSK1 |
Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 1 |
Genbank accession: | NM_002953 |
Immunogen: | RPS6KA1 (NP_002944, 342 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD |
Protein accession: | NP_002944 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.25 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |