Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPS2 monoclonal antibody (M01), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about RPS2 monoclonal antibody (M01), clone 3G6
| Brand: | Abnova |
| Reference: | H00006187-M01 |
| Product name: | RPS2 monoclonal antibody (M01), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS2. |
| Clone: | 3G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6187 |
| Gene name: | RPS2 |
| Gene alias: | LLREP3|MGC102851|MGC117344|MGC117345 |
| Gene description: | ribosomal protein S2 |
| Genbank accession: | NM_002952 |
| Immunogen: | RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT |
| Protein accession: | NP_002943 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2 ug/ml] |
| Applications: | WB-Ti,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | PRMT3 is essential for dendritic spine maturation in rat hippocampal neurons.Miyata S, Mori Y, Tohyama M. Brain Res. 2010 Sep 17;1352C:11-20. Epub 2010 Jul 18. |