Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPS2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RPS2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006187-A01 |
| Product name: | RPS2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RPS2. |
| Gene id: | 6187 |
| Gene name: | RPS2 |
| Gene alias: | LLREP3|MGC102851|MGC117344|MGC117345 |
| Gene description: | ribosomal protein S2 |
| Genbank accession: | NM_002952 |
| Immunogen: | RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT |
| Protein accession: | NP_002943 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Differential expression of novel tyrosine kinase substrates during breast cancer development.Chen Y, Choong LY, Lin Q, Philp R, Wong CH, Ang BK, Tan YL, Loh MC, Hew CL, Shah N, Druker BJ, Chong PK, Lim YP. Mol Cell Proteomics. 2007 Dec;6(12):2072-87. Epub 2007 Sep 12. |